SCOP 1.55: Domain d1dax__: 1dax -

Lineage for d1dax__ (1dax -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins)

6. Protein Ferredoxin I [54880] (1 species)

7. Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries)

8. Domain d1dax__: 1dax - [38996]

Details for d1dax__

PDB Entry: 1dax

PDB Description: oxidised desulfovibrio africanus ferredoxin i, nmr, minimized average structure

SCOP Domain Sequences for d1dax__:

Sequence; same for both SEQRES and ATOM records:

>d1dax__ d.58.1.4 (-) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)}
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

Timeline for d1dax__:

• d1dax__ appears in SCOP 1.57
  
• d1dax__ appears in the current release, SCOPe 2.08, called d1daxa_