Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins) |
Protein Ferredoxin I [54880] (1 species) |
Species Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId:873] [54881] (3 PDB entries) |
Domain d1dax__: 1dax - [38996] |
PDB Entry: 1dax (more details)
SCOP Domain Sequences for d1dax__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dax__ d.58.1.4 (-) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus)} arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih wede
Timeline for d1dax__: