![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster automatically mapped to Pfam PF13459 automatically mapped to Pfam PF13370 |
![]() | Protein Ferredoxin I [54880] (2 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [54881] (3 PDB entries) |
![]() | Domain d1daxa_: 1dax A: [38996] complexed with sf4 |
PDB Entry: 1dax (more details)
SCOPe Domain Sequences for d1daxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1daxa_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio africanus [TaxId: 873]} arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih wede
Timeline for d1daxa_: