Lineage for d7cjdd2 (7cjd D:62-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927569Protein automated matches [310868] (6 species)
    not a true protein
  7. 2927589Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (34 PDB entries)
  8. 2927623Domain d7cjdd2: 7cjd D:62-313 [389934]
    Other proteins in same PDB: d7cjda1, d7cjdb1, d7cjdc1, d7cjdd1
    automated match to d4m0wa2
    complexed with edo, zn; mutant

Details for d7cjdd2

PDB Entry: 7cjd (more details), 2.5 Å

PDB Description: crystal structure of the sars-cov-2 plpro c111s mutant
PDB Compounds: (D:) non-structural protein 3

SCOPe Domain Sequences for d7cjdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjdd2 d.3.1.23 (D:62-313) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensyttt

SCOPe Domain Coordinates for d7cjdd2:

Click to download the PDB-style file with coordinates for d7cjdd2.
(The format of our PDB-style files is described here.)

Timeline for d7cjdd2: