SCOPe 2.08: Domain d7cjdb1: 7cjd B:2-61

Lineage for d7cjdb1 (7cjd B:2-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries)

8. Domain d7cjdb1: 7cjd B:2-61 [389970]
   Other proteins in same PDB: d7cjda2, d7cjdb2, d7cjdc2, d7cjdd2
   automated match to d4m0wa1
   complexed with edo, zn; mutant

Details for d7cjdb1

PDB Entry: 7cjd, 2.5 Å

PDB Description: crystal structure of the sars-cov-2 plpro c111s mutant

PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d7cjdb1:

Sequence; same for both SEQRES and ATOM records:

>d7cjdb1 d.15.1.0 (B:2-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
vrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

Timeline for d7cjdb1:

• d7cjdb1 first appeared in SCOPe 2.07