SCOPe 2.08: Domain d7cjda2: 7cjd A:62-312

Lineage for d7cjda2 (7cjd A:62-312)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (34 PDB entries)

8. Domain d7cjda2: 7cjd A:62-312 [389947]
   Other proteins in same PDB: d7cjda1, d7cjdb1, d7cjdc1, d7cjdd1
   automated match to d4m0wa2
   complexed with edo, zn; mutant

Details for d7cjda2

PDB Entry: 7cjd, 2.5 Å

PDB Description: crystal structure of the sars-cov-2 plpro c111s mutant

PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d7cjda2:

Sequence; same for both SEQRES and ATOM records:

>d7cjda2 d.3.1.23 (A:62-312) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensytt

Timeline for d7cjda2:

• d7cjda2 first appeared in SCOPe 2.07