Lineage for d1f2g__ (1f2g -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32368Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein)
  6. 32369Protein Ferredoxin II [54864] (5 species)
  7. 32378Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries)
  8. 32380Domain d1f2g__: 1f2g - [38942]

Details for d1f2g__

PDB Entry: 1f2g (more details)

PDB Description: the nmr solution structure of the 3fe ferredoxin ii from desulfovibrio gigas, 15 structures

SCOP Domain Sequences for d1f2g__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2g__ d.58.1.1 (-) Ferredoxin II {Desulfovibrio gigas}
pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs

SCOP Domain Coordinates for d1f2g__:

Click to download the PDB-style file with coordinates for d1f2g__.
(The format of our PDB-style files is described here.)

Timeline for d1f2g__: