Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein) |
Protein Ferredoxin II [54864] (5 species) |
Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries) |
Domain d1f2g__: 1f2g - [38942] |
PDB Entry: 1f2g (more details)
SCOP Domain Sequences for d1f2g__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2g__ d.58.1.1 (-) Ferredoxin II {Desulfovibrio gigas} pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs
Timeline for d1f2g__: