Lineage for d1f2ga_ (1f2g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949195Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2949214Protein Ferredoxin I [54880] (2 species)
  7. 2949220Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries)
  8. 2949222Domain d1f2ga_: 1f2g A: [38942]
    complexed with f3s

Details for d1f2ga_

PDB Entry: 1f2g (more details)

PDB Description: the nmr solution structure of the 3fe ferredoxin ii from desulfovibrio gigas, 15 structures
PDB Compounds: (A:) ferredoxin II

SCOPe Domain Sequences for d1f2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ga_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}
pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs

SCOPe Domain Coordinates for d1f2ga_:

Click to download the PDB-style file with coordinates for d1f2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1f2ga_: