Lineage for d6kz7a_ (6kz7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692777Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2692785Domain d6kz7a_: 6kz7 A: [388897]
    Other proteins in same PDB: d6kz7c2
    automated match to d5gjka_

Details for d6kz7a_

PDB Entry: 6kz7 (more details), 2.28 Å

PDB Description: the crystal structure of baf155 swirm domain and n-terminal elongated hsnf5 rpt1 domain complex: chromatin remodeling complex
PDB Compounds: (A:) SWI/SNF complex subunit SMARCC1

SCOPe Domain Sequences for d6kz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kz7a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiipsyaswfdyncihvierralpeffngknksktpeiylayrnfmidtyrlnpqeylts
tacrrnltgdvcavmrvhafleqwglvnyqvdpe

SCOPe Domain Coordinates for d6kz7a_:

Click to download the PDB-style file with coordinates for d6kz7a_.
(The format of our PDB-style files is described here.)

Timeline for d6kz7a_: