Lineage for d1ec8a2 (1ec8 A:5-137)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32241Protein D-glucarate dehydratase [54831] (2 species)
  7. 32242Species Escherichia coli [TaxId:562] [54833] (4 PDB entries)
  8. 32247Domain d1ec8a2: 1ec8 A:5-137 [38866]
    Other proteins in same PDB: d1ec8a1, d1ec8b1, d1ec8c1, d1ec8d1

Details for d1ec8a2

PDB Entry: 1ec8 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate

SCOP Domain Sequences for d1ec8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec8a2 d.54.1.1 (A:5-137) D-glucarate dehydratase {Escherichia coli}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOP Domain Coordinates for d1ec8a2:

Click to download the PDB-style file with coordinates for d1ec8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ec8a2: