PDB entry 1ec8

View 1ec8 on RCSB PDB site
Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate
Deposited on 2000-01-25, released 2000-05-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec8A (A:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec8B (B:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec8C (C:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ec8D (D:)
    fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
    ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
    gqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamt
    pdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslne
    aikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlsl
    qsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkita
    idthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardd
    amgmqylipgwtfdnkrpcmvr