SCOPe 2.08: Domain d1gpma3: 1gpm A:405-525

Lineage for d1gpma3 (1gpm A:405-525)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families)
   automatically mapped to Pfam PF00958

5. Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)

6. Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)

7. Species Escherichia coli [TaxId:562] [54813] (1 PDB entry)

8. Domain d1gpma3: 1gpm A:405-525 [38826]
   Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2
   complexed with amp, cit, mg, po4, pop

Details for d1gpma3

PDB Entry: 1gpm, 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

PDB Compounds: (A:) gmp synthetase

SCOPe Domain Sequences for d1gpma3:

Sequence; same for both SEQRES and ATOM records:

>d1gpma3 d.52.2.1 (A:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli [TaxId: 562]}
gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr
kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew
e

Timeline for d1gpma3:

• d1gpma3 first appeared (with stable ids) in SCOP 1.55
  
• d1gpma3 appears in SCOPe 2.07