SCOPe 2.08: Domain d1gpmb1: 1gpm B:208-404

Lineage for d1gpmb1 (1gpm B:208-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein GMP synthetase, central domain [52404] (2 species)

7. Species Escherichia coli [TaxId:562] [52405] (1 PDB entry)

8. Domain d1gpmb1: 1gpm B:208-404 [31609]
   Other proteins in same PDB: d1gpma2, d1gpma3, d1gpmb2, d1gpmb3, d1gpmc2, d1gpmc3, d1gpmd2, d1gpmd3
   complexed with amp, cit, mg, po4, pop

Details for d1gpmb1

PDB Entry: 1gpm, 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

PDB Compounds: (B:) gmp synthetase

SCOPe Domain Sequences for d1gpmb1:

Sequence, based on SEQRES records:

>d1gpmb1 c.26.2.1 (B:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]}
wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl
neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle
dvkwlaqgtiypdviesaasatgkahvikshhnvgglpkemkmglveplkelfkdevrki
glelglpydmlyrhpfp

Sequence, based on observed residues (ATOM records):

>d1gpmb1 c.26.2.1 (B:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]}
wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl
neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle
dvkwlaqgtiypdviemkmglveplkelfkdevrkiglelglpydmlyrhpfp

Timeline for d1gpmb1:

• d1gpmb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gpmb1 appears in SCOPe 2.07