Lineage for d1gpmc2 (1gpm C:3-207)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858873Protein GMP synthetase [52319] (2 species)
  7. 2858874Species Escherichia coli [TaxId:562] [52320] (1 PDB entry)
  8. 2858877Domain d1gpmc2: 1gpm C:3-207 [31407]
    Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3
    complexed with amp, cit, mg, po4, pop

Details for d1gpmc2

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate
PDB Compounds: (C:) gmp synthetase

SCOPe Domain Sequences for d1gpmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpmc2 c.23.16.1 (C:3-207) GMP synthetase {Escherichia coli [TaxId: 562]}
enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
evthtrqgmrmlerfvrdicqceal

SCOPe Domain Coordinates for d1gpmc2:

Click to download the PDB-style file with coordinates for d1gpmc2.
(The format of our PDB-style files is described here.)

Timeline for d1gpmc2: