Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) automatically mapped to Pfam PF00137 |
Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins) |
Protein automated matches [367200] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [386971] (4 PDB entries) |
Domain d6oqtn_: 6oqt N: [388147] Other proteins in same PDB: d6oqtd1, d6oqtd2, d6oqtd3, d6oqte1, d6oqte2, d6oqte3, d6oqtf1, d6oqtf2, d6oqtf3, d6oqtg_, d6oqth1, d6oqth2 automated match to d1l6ta_ complexed with adp, atp, mg, po4 |
PDB Entry: 6oqt (more details), 3.1 Å
SCOPe Domain Sequences for d6oqtn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oqtn_ f.17.1.1 (N:) automated matches {Escherichia coli [TaxId: 562]} nlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglvda ipmiavglglyvmfava
Timeline for d6oqtn_: