Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) automatically mapped to Pfam PF00137 |
Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins) |
Protein F1F0 ATP synthase subunit C [56891] (1 species) |
Species Escherichia coli [TaxId:562] [56892] (6 PDB entries) |
Domain d1l6ta_: 1l6t A: [73629] Ala24/Asp61 to Asp24/Asn61 substituted |
PDB Entry: 1l6t (more details)
SCOPe Domain Sequences for d1l6ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ta_ f.17.1.1 (A:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]} menlnmdllymaaavmmglaaigdaigigilggkflegaarqpdlipllrtqffivmglv naipmiavglglyvmfava
Timeline for d1l6ta_: