PDB entry 1l6t

View 1l6t on RCSB PDB site
Description: structure of ala24/asp61 to asp24/asn61 substituted subunit c of escherichia coli ATP synthase
Class: hydrolase
Keywords: transmembrane helix, hydrolase
Deposited on 2002-03-13, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP synthase c chain
  Species: Escherichia coli [TaxId:562]
  Gene: UNCE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68699 (0-78)
    • engineered (23)
    • engineered (60)
  Domains in SCOPe 2.07: d1l6ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l6tA (A:)
  menlnmdllymaaavmmglaaigdaigigilggkflegaarqpdlipllrtqffivmglv
  naipmiavglglyvmfava