SCOPe 2.07: Domain d6oqte3: 6oqt E:344-459

Lineage for d6oqte3 (6oqt E:344-459)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [388137] (2 PDB entries)

8. Domain d6oqte3: 6oqt E:344-459 [388185]
   Other proteins in same PDB: d6oqtd1, d6oqtd2, d6oqte1, d6oqte2, d6oqtf1, d6oqtf2, d6oqtg_, d6oqth1, d6oqth2, d6oqti_, d6oqtj_, d6oqtl_, d6oqtm_, d6oqtn_, d6oqto_, d6oqtp_, d6oqtq_, d6oqtr_, d6oqts_
   automated match to d4q4la3
   complexed with adp, atp, mg, po4

Details for d6oqte3

PDB Entry: 6oqt, 3.1 Å

PDB Description: e. coli atp synthase state 1c

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqte3:

Sequence; same for both SEQRES and ATOM records:

>d6oqte3 a.69.1.0 (E:344-459) automated matches {Escherichia coli [TaxId: 562]}
ldplvvgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqp
ffvaevftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl

Timeline for d6oqte3:

• d6oqte3 is new in SCOPe 2.07-stable
  
• d6oqte3 appears in the current release, SCOPe 2.08