Lineage for d6oqtf1 (6oqt F:2-74)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408357Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2408358Protein automated matches [254527] (17 species)
    not a true protein
  7. 2408444Species Escherichia coli [TaxId:562] [388132] (2 PDB entries)
  8. 2408447Domain d6oqtf1: 6oqt F:2-74 [388253]
    Other proteins in same PDB: d6oqtd2, d6oqtd3, d6oqte2, d6oqte3, d6oqtf2, d6oqtf3, d6oqtg_, d6oqth1, d6oqth2, d6oqti_, d6oqtj_, d6oqtl_, d6oqtm_, d6oqtn_, d6oqto_, d6oqtp_, d6oqtq_, d6oqtr_, d6oqts_
    automated match to d4q4la1
    complexed with adp, atp, mg, po4

Details for d6oqtf1

PDB Entry: 6oqt (more details), 3.1 Å

PDB Description: e. coli atp synthase state 1c
PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqtf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oqtf1 b.49.1.0 (F:2-74) automated matches {Escherichia coli [TaxId: 562]}
tgkivqvigavvdvefpqdavprvydalevqngnerlvlevqqqlgggivrtiamgssdg
lrrgldvkdlehp

SCOPe Domain Coordinates for d6oqtf1:

Click to download the PDB-style file with coordinates for d6oqtf1.
(The format of our PDB-style files is described here.)

Timeline for d6oqtf1: