Lineage for d6p6uo2 (6p6u O:160-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2605180Protein automated matches [226882] (10 species)
    not a true protein
  7. 2605327Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (7 PDB entries)
  8. 2605386Domain d6p6uo2: 6p6u O:160-331 [388042]
    Other proteins in same PDB: d6p6ua1, d6p6ub1, d6p6uc1, d6p6ud1, d6p6ue1, d6p6uf1, d6p6ug1, d6p6uh1, d6p6ui1, d6p6uj1, d6p6uk1, d6p6ul1, d6p6um1, d6p6un1, d6p6uo1, d6p6up1
    automated match to d4i9ha2
    complexed with amp

Details for d6p6uo2

PDB Entry: 6p6u (more details), 2.42 Å

PDB Description: crystal structure of monoclinic rabbit muscle lactate dehydrogenase with four tetramers as the asymmetric unit
PDB Compounds: (O:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6p6uo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p6uo2 d.162.1.1 (O:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d6p6uo2:

Click to download the PDB-style file with coordinates for d6p6uo2.
(The format of our PDB-style files is described here.)

Timeline for d6p6uo2: