Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (10 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (7 PDB entries) |
Domain d6p6ui2: 6p6u I:160-331 [387748] Other proteins in same PDB: d6p6ua1, d6p6ub1, d6p6uc1, d6p6ud1, d6p6ue1, d6p6uf1, d6p6ug1, d6p6uh1, d6p6ui1, d6p6uj1, d6p6uk1, d6p6ul1, d6p6um1, d6p6un1, d6p6uo1, d6p6up1 automated match to d4i9ha2 complexed with amp |
PDB Entry: 6p6u (more details), 2.42 Å
SCOPe Domain Sequences for d6p6ui2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p6ui2 d.162.1.1 (I:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
Timeline for d6p6ui2:
View in 3D Domains from other chains: (mouse over for more information) d6p6ua1, d6p6ua2, d6p6ub1, d6p6ub2, d6p6uc1, d6p6uc2, d6p6ud1, d6p6ud2, d6p6ue1, d6p6ue2, d6p6uf1, d6p6uf2, d6p6ug1, d6p6ug2, d6p6uh1, d6p6uh2, d6p6uj1, d6p6uj2, d6p6uk1, d6p6uk2, d6p6ul1, d6p6ul2, d6p6um1, d6p6um2, d6p6un1, d6p6un2, d6p6uo1, d6p6uo2, d6p6up1, d6p6up2 |