Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (3 PDB entries) |
Domain d6p6ui1: 6p6u I:1-159 [387747] Other proteins in same PDB: d6p6ua2, d6p6ub2, d6p6uc2, d6p6ud2, d6p6ue2, d6p6uf2, d6p6ug2, d6p6uh2, d6p6ui2, d6p6uj2, d6p6uk2, d6p6ul2, d6p6um2, d6p6un2, d6p6uo2, d6p6up2 automated match to d5nqba1 complexed with amp |
PDB Entry: 6p6u (more details), 2.42 Å
SCOPe Domain Sequences for d6p6ui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p6ui1 c.2.1.5 (I:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d6p6ui1:
View in 3D Domains from other chains: (mouse over for more information) d6p6ua1, d6p6ua2, d6p6ub1, d6p6ub2, d6p6uc1, d6p6uc2, d6p6ud1, d6p6ud2, d6p6ue1, d6p6ue2, d6p6uf1, d6p6uf2, d6p6ug1, d6p6ug2, d6p6uh1, d6p6uh2, d6p6uj1, d6p6uj2, d6p6uk1, d6p6uk2, d6p6ul1, d6p6ul2, d6p6um1, d6p6um2, d6p6un1, d6p6un2, d6p6uo1, d6p6uo2, d6p6up1, d6p6up2 |