SCOPe 2.07: Domain d6p6up2: 6p6u P:160-331

Lineage for d6p6up2 (6p6u P:160-331)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (7 PDB entries)

8. Domain d6p6up2: 6p6u P:160-331 [388026]
   Other proteins in same PDB: d6p6ua1, d6p6ub1, d6p6uc1, d6p6ud1, d6p6ue1, d6p6uf1, d6p6ug1, d6p6uh1, d6p6ui1, d6p6uj1, d6p6uk1, d6p6ul1, d6p6um1, d6p6un1, d6p6uo1, d6p6up1
   automated match to d4i9ha2
   complexed with amp

Details for d6p6up2

PDB Entry: 6p6u, 2.42 Å

PDB Description: crystal structure of monoclinic rabbit muscle lactate dehydrogenase with four tetramers as the asymmetric unit

PDB Compounds: (P:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6p6up2:

Sequence; same for both SEQRES and ATOM records:

>d6p6up2 d.162.1.1 (P:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

Timeline for d6p6up2:

• d6p6up2 is new in SCOPe 2.07-stable
  
• d6p6up2 appears in the current release, SCOPe 2.08