Lineage for d6kz0j1 (6kz0 J:1-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798440Species Human rhinovirus 14 [TaxId:12131] [255241] (3 PDB entries)
  8. 2798446Domain d6kz0j1: 6kz0 J:1-179 [386159]
    Other proteins in same PDB: d6kz0a2, d6kz0b_, d6kz0c_, d6kz0d2, d6kz0e_, d6kz0f_, d6kz0g2, d6kz0h_, d6kz0i_, d6kz0j2, d6kz0k_, d6kz0l_
    automated match to d2in2a_

Details for d6kz0j1

PDB Entry: 6kz0 (more details), 2.4 Å

PDB Description: hrv14 3c in complex with single chain antibody ggvv
PDB Compounds: (J:) Genome polyprotein

SCOPe Domain Sequences for d6kz0j1:

Sequence, based on SEQRES records: (download)

>d6kz0j1 b.47.1.0 (J:1-179) automated matches {Human rhinovirus 14 [TaxId: 12131]}
gpntefalsllrknimtittskgeftglgihdrvcvipthaqpgddvlvngqkirvkdky
klvdpeninleltvltldrnekfrdirgfisedlegvdatlvvhsnnftntilevgpvtm
aglinlsstptnrmirydyatktgqcggvlcatgkifgihvggngrqgfsaqlkkqyfv

Sequence, based on observed residues (ATOM records): (download)

>d6kz0j1 b.47.1.0 (J:1-179) automated matches {Human rhinovirus 14 [TaxId: 12131]}
gpntefalsllrknimtittskgeftglgihdrvcvipthaqpgddvlvngqkirvkdky
klvdleltvltldrnekfrdirgfisedlegvdatlvvhsnnftntilevgpvtmarmir
ydyatktgqcggvlcatgkifgihvggngrqgfsaqlkkqyfv

SCOPe Domain Coordinates for d6kz0j1:

Click to download the PDB-style file with coordinates for d6kz0j1.
(The format of our PDB-style files is described here.)

Timeline for d6kz0j1: