Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6kz0h_: 6kz0 H: [386170] Other proteins in same PDB: d6kz0a1, d6kz0a2, d6kz0c_, d6kz0d1, d6kz0d2, d6kz0f_, d6kz0g1, d6kz0g2, d6kz0i_, d6kz0j1, d6kz0j2, d6kz0l_ automated match to d4kfzc_ |
PDB Entry: 6kz0 (more details), 2.4 Å
SCOPe Domain Sequences for d6kz0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kz0h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkqpgssvkvscktsgdifstygfnwvrqapgqglewmggiapvfdtlky aqrfqgrllitadesatsvymelsslrsddtavyycaragqggvvgnyldywgqgtlvtv ss
Timeline for d6kz0h_: