Lineage for d6kz0b_ (6kz0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757670Domain d6kz0b_: 6kz0 B: [386167]
    Other proteins in same PDB: d6kz0a1, d6kz0a2, d6kz0c_, d6kz0d1, d6kz0d2, d6kz0f_, d6kz0g1, d6kz0g2, d6kz0i_, d6kz0j1, d6kz0j2, d6kz0l_
    automated match to d4kfzc_

Details for d6kz0b_

PDB Entry: 6kz0 (more details), 2.4 Å

PDB Description: hrv14 3c in complex with single chain antibody ggvv
PDB Compounds: (B:) GGVV H chain

SCOPe Domain Sequences for d6kz0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kz0b_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkqpgssvkvscktsgdifstygfnwvrqapgqglewmggiapvfdtlkya
qrfqgrllitadesatsvymelsslrsddtavyycaragqggvvgnyldywgqgtlvtvs
s

SCOPe Domain Coordinates for d6kz0b_:

Click to download the PDB-style file with coordinates for d6kz0b_.
(The format of our PDB-style files is described here.)

Timeline for d6kz0b_: