SCOPe 2.08: Domain d6wn8i1: 6wn8 I:1-208

Lineage for d6wn8i1 (6wn8 I:1-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:72407] [385212] (1 PDB entry)

8. Domain d6wn8i1: 6wn8 I:1-208 [385307]
   Other proteins in same PDB: d6wn8a2, d6wn8b2, d6wn8c2, d6wn8d2, d6wn8e2, d6wn8f2, d6wn8g2, d6wn8h2, d6wn8i2, d6wn8j2
   automated match to d1v9sa1
   complexed with bdf, cl, so4

Details for d6wn8i1

PDB Entry: 6wn8, 2.7 Å

PDB Description: 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae

PDB Compounds: (I:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d6wn8i1:

Sequence; same for both SEQRES and ATOM records:

>d6wn8i1 c.61.1.0 (I:1-208) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
mkivevkhplvkhklglmrehdistkrfrelasevgslltyeatadletekvtiegwngp
veveqikgkkitvvpilraglgmmegvlehvpsarisvvgiyrneetlepvpyfqklvsn
idermalvvdpmlatggsmiatidllknagctsikvlvlvaapegiaalekahpdvelyt
asvdkglnehgyiipglgdagdkifgtk

Timeline for d6wn8i1:

• d6wn8i1 first appeared in SCOPe 2.07