Lineage for d1v9sa1 (1v9s A:1-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891628Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2891663Species Thermus thermophilus [TaxId:274] [142554] (1 PDB entry)
    Uniprot Q72J35 1-208
  8. 2891664Domain d1v9sa1: 1v9s A:1-208 [119894]
    Other proteins in same PDB: d1v9sb_, d1v9sc_, d1v9sd_
    complexed with so4

Details for d1v9sa1

PDB Entry: 1v9s (more details), 2.1 Å

PDB Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8
PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1v9sa1:

Sequence, based on SEQRES records: (download)

>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
aaiderlndhgyivpglgdagdriygtk

Sequence, based on observed residues (ATOM records): (download)

>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyqyyiklppdiaerrafll
dpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvvaaiderlnd
hgyivpglgdagdriygtk

SCOPe Domain Coordinates for d1v9sa1:

Click to download the PDB-style file with coordinates for d1v9sa1.
(The format of our PDB-style files is described here.)

Timeline for d1v9sa1: