Lineage for d1v9sb_ (1v9s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891731Protein automated matches [190074] (15 species)
    not a true protein
  7. 2891789Species Thermus thermophilus HB8 [TaxId:300852] [186795] (1 PDB entry)
  8. 2891790Domain d1v9sb_: 1v9s B: [119895]
    Other proteins in same PDB: d1v9sa1
    automated match to d1i5ea_
    complexed with so4

Details for d1v9sb_

PDB Entry: 1v9s (more details), 2.1 Å

PDB Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1v9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9sb_ c.61.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
aaiderlndhgyivpglgdagdriygtk

SCOPe Domain Coordinates for d1v9sb_:

Click to download the PDB-style file with coordinates for d1v9sb_.
(The format of our PDB-style files is described here.)

Timeline for d1v9sb_: