PDB entry 1v9s

View 1v9s on RCSB PDB site
Description: Crystal structure of TT0130 protein from Thermus thermophilus HB8
Class: transferase
Keywords: pyrimidine salvage, oligomerization, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2004-01-29, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J35 (0-207)
      • modified residue (0)
      • modified residue (36)
      • modified residue (38)
      • modified residue (43)
      • modified residue (82)
      • modified residue (131)
      • modified residue (156)
    Domains in SCOPe 2.07: d1v9sa1
  • Chain 'B':
    Compound: uracil phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J35 (0-207)
      • modified residue (0)
      • modified residue (36)
      • modified residue (38)
      • modified residue (43)
      • modified residue (82)
      • modified residue (131)
      • modified residue (156)
    Domains in SCOPe 2.07: d1v9sb_
  • Chain 'C':
    Compound: uracil phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J35 (0-207)
      • modified residue (0)
      • modified residue (36)
      • modified residue (38)
      • modified residue (43)
      • modified residue (82)
      • modified residue (131)
      • modified residue (156)
    Domains in SCOPe 2.07: d1v9sc_
  • Chain 'D':
    Compound: uracil phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J35 (0-207)
      • modified residue (0)
      • modified residue (36)
      • modified residue (38)
      • modified residue (43)
      • modified residue (82)
      • modified residue (131)
      • modified residue (156)
    Domains in SCOPe 2.07: d1v9sd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9sA (A:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
    iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
    aaiderlndhgyivpglgdagdriygtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9sA (A:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyqyyiklppdiaerrafll
    dpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvvaaiderlnd
    hgyivpglgdagdriygtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9sB (B:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
    iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
    aaiderlndhgyivpglgdagdriygtk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9sC (C:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
    iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
    aaiderlndhgyivpglgdagdriygtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v9sD (D:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyrdpeslnpvqyyiklppd
    iaerraflldpmlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvv
    aaiderlndhgyivpglgdagdriygtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9sD (D:)
    mritlvdhplvqhklahlrdkrtgpkdfrelaeevamlmayeamrdleleettvetpiap
    arvkvlsgkklalvailraglvmvegilklvpharvghiglyyiklppdiaerraflldp
    mlatggsaslalsllkergatgvklmailaapegleriakdhpdtevvvaaiderlndhg
    yivpglgdagdriygtk