Lineage for d6wn8b1 (6wn8 B:1-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892029Species Klebsiella pneumoniae [TaxId:72407] [385212] (1 PDB entry)
  8. 2892031Domain d6wn8b1: 6wn8 B:1-208 [385292]
    Other proteins in same PDB: d6wn8a2, d6wn8b2, d6wn8c2, d6wn8d2, d6wn8e2, d6wn8f2, d6wn8g2, d6wn8h2, d6wn8i2, d6wn8j2
    automated match to d1v9sa1
    complexed with bdf, cl, so4

Details for d6wn8b1

PDB Entry: 6wn8 (more details), 2.7 Å

PDB Description: 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d6wn8b1:

Sequence, based on SEQRES records: (download)

>d6wn8b1 c.61.1.0 (B:1-208) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
mkivevkhplvkhklglmrehdistkrfrelasevgslltyeatadletekvtiegwngp
veveqikgkkitvvpilraglgmmegvlehvpsarisvvgiyrneetlepvpyfqklvsn
idermalvvdpmlatggsmiatidllknagctsikvlvlvaapegiaalekahpdvelyt
asvdkglnehgyiipglgdagdkifgtk

Sequence, based on observed residues (ATOM records): (download)

>d6wn8b1 c.61.1.0 (B:1-208) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
mkivevkhplvkhklglmrehdistkrfrelasevgslltyeatadletekvtiegwngp
veveqikgkkitvvpilraglgmmegvlehvpsarisvvgiyrnepvpyfqklvsnider
malvvdpmlatggsmiatidllknagctsikvlvlvaapegiaalekahpdvelytasvd
kglnehgyiipglgdagdkifgtk

SCOPe Domain Coordinates for d6wn8b1:

Click to download the PDB-style file with coordinates for d6wn8b1.
(The format of our PDB-style files is described here.)

Timeline for d6wn8b1: