Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:72407] [385212] (1 PDB entry) |
Domain d6wn8d1: 6wn8 D:1-208 [385213] Other proteins in same PDB: d6wn8a2, d6wn8b2, d6wn8c2, d6wn8d2, d6wn8e2, d6wn8f2, d6wn8g2, d6wn8h2, d6wn8i2, d6wn8j2 automated match to d1v9sa1 complexed with bdf, cl, so4 |
PDB Entry: 6wn8 (more details), 2.7 Å
SCOPe Domain Sequences for d6wn8d1:
Sequence, based on SEQRES records: (download)
>d6wn8d1 c.61.1.0 (D:1-208) automated matches {Klebsiella pneumoniae [TaxId: 72407]} mkivevkhplvkhklglmrehdistkrfrelasevgslltyeatadletekvtiegwngp veveqikgkkitvvpilraglgmmegvlehvpsarisvvgiyrneetlepvpyfqklvsn idermalvvdpmlatggsmiatidllknagctsikvlvlvaapegiaalekahpdvelyt asvdkglnehgyiipglgdagdkifgtk
>d6wn8d1 c.61.1.0 (D:1-208) automated matches {Klebsiella pneumoniae [TaxId: 72407]} mkivevkhplvkhklglmrehdistkrfrelasevgslltyeatadletekvtiegwngp veveqikgkkitvvpilraglgmmegvlehvpsarisvvgiyrepvpyfqklvsniderm alvvdpmlatggsmiatidllknagctsikvlvlvaapegiaalekahpdvelytasvdk glnehgyiipglgdagdkifgtk
Timeline for d6wn8d1: