Lineage for d1mpyb2 (1mpy B:146-307)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31626Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 31627Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) (S)
  5. 31662Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 31688Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
  7. 31689Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
  8. 31693Domain d1mpyb2: 1mpy B:146-307 [38511]

Details for d1mpyb2

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2

SCOP Domain Sequences for d1mpyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpyb2 d.32.1.3 (B:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2}
maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih
hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne
vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt

SCOP Domain Coordinates for d1mpyb2:

Click to download the PDB-style file with coordinates for d1mpyb2.
(The format of our PDB-style files is described here.)

Timeline for d1mpyb2: