Lineage for d1mpya1 (1mpy A:1-145)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) 
Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species) Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry) 
Domain d1mpya1: 1mpy A:1-145 [38508]
Details for d1mpya1
PDB Entry: 1mpy (more details), 2.8 Å
PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2
SCOP Domain Sequences for d1mpya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2}
mnkgvmrpghvqlrvldmskalehyvellgliemdrddqgrvylkawtevdkfslvlrea
depgmdfmgfkvvdedalrqlerdlmaygcaveqlpagelnscgrrvrfqapsghhfely
adkeytgkwglndvnpeawprdlkg
SCOP Domain Coordinates for d1mpya1:
Click to download the PDB-style file with coordinates for d1mpya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mpya1:
- d1mpya1 appears in SCOP 1.57
- d1mpya1 appears in the current release, SCOPe 2.08
View in 3D
