Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
Domain d6jria_: 6jri A: [385019] automated match to d4grwe_ |
PDB Entry: 6jri (more details), 3.1 Å
SCOPe Domain Sequences for d6jria_:
Sequence, based on SEQRES records: (download)
>d6jria_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsmsgst tyytdsvkgrftisrdnakntlylqmnslkpedtamyycaaaryrgigsqvrwtdfiywg qgtqvtvss
>d6jria_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsttyyt dsvkgrftisrdnakntlylqmnslkpedtamyycaaaryrgigsqvrwtdfiywgqgtq vtvss
Timeline for d6jria_: