SCOPe 2.08: Domain d6jrig_: 6jri G:

Lineage for d6jrig_ (6jri G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d6jrig_: 6jri G: [384967]
   automated match to d4grwe_

Details for d6jrig_

PDB Entry: 6jri, 3.1 Å

PDB Description: crystal structure of nanobody

PDB Compounds: (G:) Nanobody

SCOPe Domain Sequences for d6jrig_:

Sequence, based on SEQRES records:

>d6jrig_ b.1.1.1 (G:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsmsgst
tyytdsvkgrftisrdnakntlylqmnslkpedtamyycaaaryrgigsqvrwtdfiywg
qgtqvtvss

Sequence, based on observed residues (ATOM records):

>d6jrig_ b.1.1.1 (G:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsmsgst
tyytdsvkgrftisrdnakntlylqmnslkpedtamyycaaarwtdfiywgqgtqvtvss

Timeline for d6jrig_:

• d6jrig_ first appeared in SCOPe 2.07