Lineage for d1emga_ (1emg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2939979Domain d1emga_: 1emg A: [38346]

Details for d1emga_

PDB Entry: 1emg (more details), 2 Å

PDB Description: green fluorescent protein (65-67 replaced by cro, s65t substitution, q80r)
PDB Compounds: (A:) protein (green fluorescent protein)

SCOPe Domain Sequences for d1emga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emga_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d1emga_:

Click to download the PDB-style file with coordinates for d1emga_.
(The format of our PDB-style files is described here.)

Timeline for d1emga_: