PDB entry 1emg

View 1emg on RCSB PDB site
Description: green fluorescent protein (65-67 replaced by cro, s65t substitution, q80r)
Class: greenfluorescent protein
Keywords: greenfluorescent protein, bioluminescence, photoactive protein, fluorescent tag, ph titration
Deposited on 1998-11-12, released 1999-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (green fluorescent protein)
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (1-228)
      • chromophore (65)
      • cloning artifact (79)
    Domains in SCOPe 2.07: d1emga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1emgA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emgA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi