| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d6obod_: 6obo D: [383102] Other proteins in same PDB: d6oboa_, d6obob_ automated match to d1wz1h_ complexed with acy, ca, edo |
PDB Entry: 6obo (more details), 1.9 Å
SCOPe Domain Sequences for d6obod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6obod_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglaqaggslrlscaasgsifsinamgwyrqapgkerelvadisgsgrtnyad
svkgrftisrdnakntvslqmnslkpedtavyycnvvggsyyydeynywgqgtqvtvsse
p
Timeline for d6obod_: