![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein automated matches [190420] (9 species) not a true protein |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries) |
![]() | Domain d6oboa_: 6obo A: [391135] Other proteins in same PDB: d6oboc_, d6obod_ automated match to d3px8x_ complexed with acy, ca, edo |
PDB Entry: 6obo (more details), 1.9 Å
SCOPe Domain Sequences for d6oboa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oboa_ d.165.1.1 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd vsilipiialmvyrcap
Timeline for d6oboa_: