Lineage for d6obob_ (6obo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000154Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)
  8. 3000160Domain d6obob_: 6obo B: [391136]
    Other proteins in same PDB: d6oboc_, d6obod_
    automated match to d3px8x_
    complexed with acy, ca, edo

Details for d6obob_

PDB Entry: 6obo (more details), 1.9 Å

PDB Description: ricin a chain bound to vhh antibody v6a6
PDB Compounds: (B:) ricin a chain

SCOPe Domain Sequences for d6obob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6obob_ d.165.1.1 (B:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcap

SCOPe Domain Coordinates for d6obob_:

Click to download the PDB-style file with coordinates for d6obob_.
(The format of our PDB-style files is described here.)

Timeline for d6obob_: