SCOPe 2.07: Domain d6um8a_: 6um8 A:

Lineage for d6um8a_ (6um8 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)

8. Domain d6um8a_: 6um8 A: [381975]
   Other proteins in same PDB: d6um8b2
   automated match to d3vq9c_
   protein/DNA complex; protein/RNA complex; complexed with 1pe, peg, qcg, so4

Details for d6um8a_

PDB Entry: 6um8, 2.33 Å

PDB Description: hiv integrase in complex with compound-14

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6um8a_:

Sequence, based on SEQRES records:

>d6um8a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d6um8a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgviesmnkelkkiigqvrdqaehlktavqmavfihnk
krgysagerivdiiatdiq

Timeline for d6um8a_:

• d6um8a_ is new in SCOPe 2.07-stable
  
• d6um8a_ appears in the current release, SCOPe 2.08