| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
| Protein automated matches [190209] (5 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries) |
| Domain d6um8b1: 6um8 B:57-209 [381990] Other proteins in same PDB: d6um8b2 automated match to d3vq9c_ protein/DNA complex; protein/RNA complex; complexed with 1pe, peg, qcg, so4 |
PDB Entry: 6um8 (more details), 2.33 Å
SCOPe Domain Sequences for d6um8b1:
Sequence, based on SEQRES records: (download)
>d6um8b1 c.55.3.2 (B:57-209) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiq
>d6um8b1 c.55.3.2 (B:57-209) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacewagikqefgviesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgysagerivdiiatdiq
Timeline for d6um8b1: