SCOPe 2.08: Domain d1hqrb2: 1hqr B:202-292

Lineage for d1hqrb2 (1hqr B:202-292)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
   Uniprot P04229 30-219

8. Domain d1hqrb2: 1hqr B:202-292 [38188]
   Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrd1, d1hqrd2
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1hqrb2

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

PDB Compounds: (B:) hla-dr beta chain

SCOPe Domain Sequences for d1hqrb2:

Sequence; same for both SEQRES and ATOM records:

>d1hqrb2 d.19.1.1 (B:202-292) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

Timeline for d1hqrb2:

• d1hqrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hqrb2 appears in SCOPe 2.07