Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries) |
Domain d6jkte2: 6jkt E:158-326 [381822] Other proteins in same PDB: d6jkta3, d6jktb3, d6jktd3, d6jkte3 automated match to d4iv5a2 complexed with gol, pal |
PDB Entry: 6jkt (more details), 2.3 Å
SCOPe Domain Sequences for d6jkte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jkte2 c.78.1.0 (E:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]} svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla
Timeline for d6jkte2: