Lineage for d6jkta1 (6jkt A:1-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907273Species Trypanosoma cruzi [TaxId:5693] [381623] (1 PDB entry)
  8. 2907274Domain d6jkta1: 6jkt A:1-157 [381625]
    Other proteins in same PDB: d6jkta3, d6jktb3, d6jktd3, d6jkte3
    automated match to d4iv5d1
    complexed with gol, pal

Details for d6jkta1

PDB Entry: 6jkt (more details), 2.3 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with n-(phosphonacetyl)-l-aspartic acid (pala).
PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6jkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jkta1 c.78.1.0 (A:1-157) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mlelppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffe
dssrtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdai
eealsvaqhpilnagngagehptqalldtltihselg

SCOPe Domain Coordinates for d6jkta1:

Click to download the PDB-style file with coordinates for d6jkta1.
(The format of our PDB-style files is described here.)

Timeline for d6jkta1: