SCOPe 2.08: Domain d4iv5d1: 4iv5 D:4-157

Lineage for d4iv5d1 (4iv5 D:4-157)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)
Family c.78.1.0: automated matches [227206] (1 protein)
not a true family
Protein automated matches [226938] (26 species)
not a true protein
Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries)
Domain d4iv5d1: 4iv5 D:4-157 [223411]
automated match to d1ml4a1
complexed with edo, po4, unx

Details for d4iv5d1

PDB Entry: 4iv5 (more details), 2.1 Å

PDB Description: X-ray crystal structure of a putative aspartate carbamoyltransferase from Trypanosoma cruzi

PDB Compounds: (D:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d4iv5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iv5d1 c.78.1.0 (D:4-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
lppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffedss
rtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaieea
lsvaqhpilnagngagehptqalldtltihselg

SCOPe Domain Coordinates for d4iv5d1:

Click to download the PDB-style file with coordinates for d4iv5d1.
(The format of our PDB-style files is described here.)

Timeline for d4iv5d1: