Lineage for d4iv5a2 (4iv5 A:158-327)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.0: automated matches [227206] (1 protein)
not a true familyProtein automated matches [226938] (26 species)
not a true protein
Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries) 
Domain d4iv5a2: 4iv5 A:158-327 [223406]
automated match to d1ml4a2
complexed with edo, po4, unx
Details for d4iv5a2
PDB Entry: 4iv5 (more details), 2.1 Å
PDB Description: X-ray crystal structure of a putative aspartate carbamoyltransferase from Trypanosoma cruzi
PDB Compounds: (A:) Aspartate carbamoyltransferase, putativeSCOPe Domain Sequences for d4iv5a2:
Sequence, based on SEQRES records: (download)
>d4iv5a2 c.78.1.0 (A:158-327) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla
Sequence, based on observed residues (ATOM records): (download)
>d4iv5a2 c.78.1.0 (A:158-327) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqaditidaarmrlakekmivmhplprndelsttv
dadpraayfrqmrygmfmrmailwsvla
SCOPe Domain Coordinates for d4iv5a2:
Click to download the PDB-style file with coordinates for d4iv5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4iv5a2:
- d4iv5a2 first appeared in SCOPe 2.03
- d4iv5a2 appears in SCOPe 2.07
View in 3D
