Lineage for d4iv5b1 (4iv5 B:3-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907177Species Trypanosoma cruzi [TaxId:353153] [226636] (8 PDB entries)
  8. 2907192Domain d4iv5b1: 4iv5 B:3-157 [223407]
    automated match to d1ml4a1
    complexed with edo, po4, unx

Details for d4iv5b1

PDB Entry: 4iv5 (more details), 2.1 Å

PDB Description: X-ray crystal structure of a putative aspartate carbamoyltransferase from Trypanosoma cruzi
PDB Compounds: (B:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d4iv5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iv5b1 c.78.1.0 (B:3-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
elppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffeds
srtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaiee
alsvaqhpilnagngagehptqalldtltihselg

SCOPe Domain Coordinates for d4iv5b1:

Click to download the PDB-style file with coordinates for d4iv5b1.
(The format of our PDB-style files is described here.)

Timeline for d4iv5b1: