Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries) |
Domain d1dlhe2: 1dlh E:3-92 [38174] Other proteins in same PDB: d1dlha1, d1dlha2, d1dlhb1, d1dlhd1, d1dlhd2, d1dlhe1 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1dlh (more details), 2.8 Å
SCOPe Domain Sequences for d1dlhe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlhe2 d.19.1.1 (E:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn sqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1dlhe2: