| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
| Domain d1dlha2: 1dlh A:3-81 [38171] Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhb2, d1dlhd1, d1dlhe1, d1dlhe2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1dlh (more details), 2.8 Å
SCOPe Domain Sequences for d1dlha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlha2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp
Timeline for d1dlha2: